SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HKP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HKP9
Domain Number 1 Region: 105-233
Classification Level Classification E-value
Superfamily GAF domain-like 2.01e-27
Family GAF domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HKP9
Sequence length 235
Comment (tr|F7HKP9|F7HKP9_CALJA) Phosphodiesterase 5A {ECO:0000313|Ensembl:ENSCJAP00000005875} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PDE5A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
LLFFKIKFREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKIS
ASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSH
LDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIR
LEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREE
Download sequence
Identical sequences F7HKP9
ENSCJAP00000005875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]