SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HKQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7HKQ9
Domain Number - Region: 143-183
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00497
Family Frizzled cysteine-rich domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HKQ9
Sequence length 449
Comment (tr|F7HKQ9|F7HKQ9_CALJA) Glypican 6 {ECO:0000313|Ensembl:ENSCJAP00000005870} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GPC6 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
EFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWA
RLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQITRSFIAARTFVQGLT
VGREVANRVSKLSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDT
EWNLFIGKKCLNRSENSSIFWASSIVSVISVKISERILKKTKNSLQVSIKVFQGCGQPKP
APALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTI
CKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMA
LRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRRE
VDSSAAQRGHSLLSCSLACTVLALQRLCR
Download sequence
Identical sequences F7HKQ9
ENSCJAP00000005870 ENSCJAP00000005870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]