SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HMK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HMK7
Domain Number 1 Region: 13-40,89-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-25
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.15e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HMK7
Sequence length 309
Comment (tr|F7HMK7|F7HMK7_CALJA) Potassium two pore domain channel subfamily K member 16 {ECO:0000313|Ensembl:ENSCJAP00000010880} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCNK16 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MPGAWLCSCWGGRVLPLLLAYVCYLLLGATIFQLLEKQAEAQSRNEFQLEKLRFLENYTC
LDQWALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNNLGTGLRAHLATIERWEDQPRRSQLLRVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFGEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLRLRQGCGAKEAPGRRPRGGSIAARGVQVTPQNF
ATSKRELGS
Download sequence
Identical sequences F7HMK7
ENSCJAP00000010880 XP_017826551.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]