SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HN14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HN14
Domain Number 1 Region: 43-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.45e-36
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HN14
Sequence length 302
Comment (tr|F7HN14|F7HN14_CALJA) QKI, KH domain containing RNA binding {ECO:0000313|Ensembl:ENSCJAP00000022659} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=QKI OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
HLKFLLLTEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFV
GRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVED
AQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLA
ATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGP
EAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAAT
GN
Download sequence
Identical sequences F7HN14
ENSMMUP00000000576 ENSCJAP00000022659 ENSCJAP00000022667 ENSMMUP00000000576 9544.ENSMMUP00000000576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]