SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HNA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HNA5
Domain Number 1 Region: 50-108
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000109
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HNA5
Sequence length 414
Comment (tr|F7HNA5|F7HNA5_CALJA) Basic helix-loop-helix and HMG-box containing 1 {ECO:0000313|Ensembl:ENSCJAP00000046401} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=BHMG1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
DRTLVLCSLLKGEDKVSLSQPHGLRVEEKWSNAEFGFGCPNQNLLLSPNRKQRKNHTSKL
QELALLLPIGLKTKKLTKKEILMHILQYIQYLQRNIDAAKALLKCHTTNVEGVLAGLGQN
PASGPARRRRHSTPSSSPSSQKSRLQGACQKPRKKKLTQMSDPEKTRTPKSRRFLALNKP
EKLVTPSPDQKGRGTGGTTTPPRCPDSCGHPRPASSSPPGDRKEGPRPKALLDLTLLDLA
EDTIHCGISSCWCQDSVQDDTPSPALLAQEDAERIHFLNKTQPHPRQLLMFHDSSHDVDE
RSLDVDPWLPAWTPEDSPQVSPLSLGPPHIDVWSTAGHPSEILRLSPSLFSSPGKLLPDE
LLEDGTEYLTQAALFEEVRLDLESSPSAYMQEAPQEKDTPAKAPEDPLEPHSLP
Download sequence
Identical sequences F7HNA5
ENSCJAP00000046401 ENSCJAP00000046401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]