SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HNY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HNY7
Domain Number 1 Region: 70-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-22
Family SCAN domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HNY7
Sequence length 146
Comment (tr|F7HNY7|F7HNY7_MACMU) Zinc finger and SCAN domain containing 2 {ECO:0000313|Ensembl:ENSMMUP00000029073} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ZSCAN2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MMAAEIPRVTTPLSPLVQVPQVEDRQKEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSA
GKGSSQEEVTKGPQGALSRLRELCRRWLRPEVHTKEQMLTVLPKEIQAWLQEHRPESSEE
AAALVEDLTQTLRDSETASCIHGCPV
Download sequence
Identical sequences F7HNY7
ENSMMUP00000033316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]