SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HTJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HTJ9
Domain Number 1 Region: 76-296
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.2e-68
Family Mismatch glycosylase 0.0000255
Further Details:      
 
Domain Number 2 Region: 342-481
Classification Level Classification E-value
Superfamily Nudix 6.59e-28
Family MutY C-terminal domain-like 0.000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HTJ9
Sequence length 533
Comment (tr|F7HTJ9|F7HTJ9_CALJA) MutY DNA glycosylase {ECO:0000313|Ensembl:ENSCJAP00000008540} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MUTYH OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRKPRAAVGSGHRKQAASQEQRQKHAKSSSQAKASTPNGMISECPGAPAGLARQLEEVVL
QASVSPYHLFRDIAEVTAFRGSLLSWYDQKKRDLPWRRQAEDEVDLDRRAYAVWVSEVML
QQTQVATVINYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVVEKL
GGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATSVVDGNVARVLCRVRAIGADPSSKL
VSQQLWSLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVQSLCRARQRVKQEQP
LASQSLLGSPDIEECAPSTGQCQLCLPPSEPWDQTLGVVNFPRKASRKPSREESSATCVL
EQPRALGGARILLVQRPNSGLLAGLWEFPSVTWEPSEPLQRKALLQELQRWAGPLPDTHL
RHLGEVVHVFSHIKLTYQVYGLALEGQTPVTTAPPGARWLTREEFHTAAVSTAVKKVFRV
YEGQQPGTCRGSKRSQVSSPSSRKKPSMGQQVLDDFFRPHISTDAPSLNSAAQ
Download sequence
Identical sequences F7HTJ9
ENSCJAP00000008540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]