SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HUB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7HUB9
Domain Number - Region: 72-114
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00471
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7HUB9
Sequence length 226
Comment (tr|F7HUB9|F7HUB9_CALJA) Transmembrane p24 trafficking protein 4 {ECO:0000313|Ensembl:ENSCJAP00000022418} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TMED4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAGVGAGPSRAMWQVLLLLALCATGARGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMW
DKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRM
ALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYRE
ERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV
Download sequence
Identical sequences F7HUB9
ENSCJAP00000022418 ENSCJAP00000022410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]