SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HWJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HWJ6
Domain Number 1 Region: 24-50,99-160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-24
Family Voltage-gated potassium channels 0.0021
Further Details:      
 
Domain Number 2 Region: 170-273
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-19
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HWJ6
Sequence length 334
Comment (tr|F7HWJ6|F7HWJ6_CALJA) Potassium channel subfamily K member {ECO:0000256|PIRNR:PIRNR038061} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCNK17 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MYRQRAGAAAKGRVQGCGCLMSSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSHSFQRD
KWALLENFTCLDRPALDSLIRDIIHAYKNGASLLSNTTSMGRWEFVGSFFFSVSTITTIG
YGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVDHCASRLGVTWQDPGKAQW
LAGSGALLSGLLLFLLLPPLLFSHMEGWSYMEGFYFSFITLSTVGFGDYVIGMNPSQRYP
LWYKNMVSLWILFGMAWQALIIKLILSQLEMPGRVCSCYRHSSEEDFKSQSWRQGPDREP
VSPSPQQGCYPEEPMEIIRHLEPSAQVVGGGKHS
Download sequence
Identical sequences F7HWJ6
ENSCJAP00000010844 ENSCJAP00000010847 XP_002746561.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]