SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HX79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HX79
Domain Number 1 Region: 36-60
Classification Level Classification E-value
Superfamily Notch domain 0.0000432
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  F7HX79
Domain Number - Region: 564-636
Classification Level Classification E-value
Superfamily EF-hand 0.00166
Family Parvalbumin 0.071
Further Details:      
 
Domain Number - Region: 99-126
Classification Level Classification E-value
Superfamily Notch domain 0.00628
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HX79
Sequence length 846
Comment (tr|F7HX79|F7HX79_CALJA) N-acetylglucosamine-1-phosphate transferase alpha and beta subunits {ECO:0000313|Ensembl:ENSCJAP00000002948} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GNPTAB OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCS
GNSGGSRYIAGGGGTGSIGVGQPWQFGGGINSVSYCNQGCANSWLADKFCDQACNVLSCG
FDAGDCGQDHFHELYKVTLLPNQTHYIIPKGECLPYFSFAEIAKRGIEGAYSDNPVIRHA
SIANKWKTIHLIMHSGMNATTIHFNLTFQNTNDEEFKIQIAVEVDTREGSKLNSTIQKAY
ENLVSPITLAPEAEILFEDIPKEKRFPKFKRHDINSTRRPQEEVKIPLVNISLLPKEAQL
SLSNLDLQLEHGDITLKGYNLSKSVLLRSFLMNSQHAKVKHQPIITDETNDRLVAPQEKQ
VHKSILPNSLGVSERLQRLTFPAVSVKVNGHDQGQNPPLDLETKARFGSETHIQKSGGGN
VTKEKPSPLIVLLESQMTKEKKITGKEKENRMEENAENHLGVTEVLPGRKLQYYTDSYLG
FLPWEKKKYFQDLLDEEESLKTQLAYFTDSKNTGRQLKDTFADSLRYVNKILNSKFGFTS
RKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNI
SQVFDEVDTDQSGVLSDREIRTLATRIHELPLSLQDLTGLEHMLINCSKMLPADITQLNN
IPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNV
SHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRN
RFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTIFSFFAEQLIALKRKIFPRRRIHKEAS
PDRIRV
Download sequence
Identical sequences F7HX79
ENSCJAP00000002948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]