SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HXY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HXY2
Domain Number 1 Region: 140-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.56e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HXY2
Sequence length 381
Comment (tr|F7HXY2|F7HXY2_CALJA) KRR-R motif-containing protein 1 {ECO:0000256|PIRNR:PIRNR006515} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KRR1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MASSSLERPEKAAGKSEFRNQKLKPDNQDESELLTVPDGWKEPAFSKEDNPRGLLEESSF
ATLFPKYREAYLKECWPLVQKALIEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLI
RLLARSVSFEQKAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLT
NCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKSLMIKRELAKDSELRSQSW
ERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKM
EAIKAKQAEAISKRQEERNKAFIPPKEKPVVKPKKASTETKIDVASIKEKVKKAKNKKLG
ALTAEEIALKMEAGEKKRKKK
Download sequence
Identical sequences F7HXY2
ENSCJAP00000002073 ENSCJAP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]