SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I1C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I1C3
Domain Number 1 Region: 18-116
Classification Level Classification E-value
Superfamily DEATH domain 4.24e-21
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 680-755
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000506
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  F7I1C3
Domain Number - Region: 177-438
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7I1C3
Sequence length 1052
Comment (tr|F7I1C3|F7I1C3_CALJA) Caspase recruitment domain family member 11 {ECO:0000313|Ensembl:ENSCJAP00000034795} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CARD11 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
KGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVL
NAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVE
EGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTRMELLTFQERYY
KMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEE
ECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQAGKRSLPDSDKAI
LDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELKCSTLGKDCEMY
KHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIEM
VRREACIVNLESKLRRLSKDSSNLDQSLPRNLPVTIISQNLGDASPRTNGQEADDSSTSE
ESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRASDFQAKGHEEEGTDTSPSSCGS
LPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTVEEDNDSGGFDALDL
DDDSHERYSFGPPSVHSSSSSHQSEGLDAYDLEQVNLMFRKFSLERPFRPSVTSVGHVRG
PGPSVQHTTLNGDSLISQLTLVGGNVRGSFVHSVKPGSLAEKAGLREGHQLLLLEGCIRG
ERQSVPLDTCTKEEARWTIQRCSGPVTLHYKVNHEGYRKLLKDMEDGLITSGDSFYIRLN
LNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARVDPFTGHDLDMGTIPSYSRAQQL
LLVKLQRLMHRGSREEVDGAHHTLRALRNTLQPEEALSSSDPRVSPRLSRASFLFGQLLQ
VRLSRRHPNQNDRAFASPVSFHPLTDRLEDSLFAVQILIERSEALDPESELGKNLSLIPY
SLVRAFYCERRRPVLFTPTSLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRKQKMETI
IYSREKNPNTFECISPSNIEAVAAKNKHCLLE
Download sequence
Identical sequences F7I1C3
ENSCJAP00000034795 ENSCJAP00000034795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]