SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I1D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I1D3
Domain Number 1 Region: 75-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7I1D3
Sequence length 133
Comment (tr|F7I1D3|F7I1D3_CALJA) Nescient helix-loop-helix 2 {ECO:0000313|Ensembl:ENSCJAP00000010600} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NHLH2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MMLSPDQAADSDHPSSAHSDPESLGGADAKVLGSVSDEPVEEAEGDKGGSRVALYPHPQQ
LSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
Download sequence
Identical sequences F7I1D3
ENSCJAP00000010600 ENSCJAP00000010600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]