SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I1M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I1M2
Domain Number 1 Region: 338-701
Classification Level Classification E-value
Superfamily SIS domain 4.73e-97
Family double-SIS domain 0.00000075
Further Details:      
 
Domain Number 2 Region: 3-214,269-313
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.39e-49
Family Class II glutamine amidotransferases 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7I1M2
Sequence length 701
Comment (tr|F7I1M2|F7I1M2_CALJA) Glutamine--fructose-6-phosphate transaminase 1 {ECO:0000313|Ensembl:ENSCJAP00000035541} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GFPT1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
LAGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDISFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRDRGGSPLLNGVRSEHQLFTDHITILYRTARTQIGSKFT
RWGSQGERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDD
VAAVVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTM
RGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVEL
ASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDC
GVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEV
LSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALQNKKIHMIYLRGNLTSRLKHGPL
ALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHS
VDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences F7I1M2
ENSCJAP00000035541 ENSCJAP00000035541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]