SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I2K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I2K1
Domain Number 1 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 3.79e-18
Family Assembly domain of cartilage oligomeric matrix protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7I2K1
Sequence length 129
Comment (tr|F7I2K1|F7I2K1_CALJA) Cartilage oligomeric matrix protein {ECO:0000313|Ensembl:ENSCJAP00000002048} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=COMP OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVPATACVLLFTMAALGVSGQGQIPSGSDLGPQMLRELRETNAALQDVRELLRQQVREIT
FLKNTVMECDACGERVQRPPLLPPRPLYQHQPGIPLRGLPAGVQRPHPRGRGAGFRQDQQ
AGLHGHQRV
Download sequence
Identical sequences F7I2K1
ENSCJAP00000002048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]