SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I4X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I4X9
Domain Number 1 Region: 165-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.48e-16
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000321
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  F7I4X9
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00982
Family LIM domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7I4X9
Sequence length 402
Comment (tr|F7I4X9|F7I4X9_CALJA) LIM/homeobox protein Lhx5 {ECO:0000313|EMBL:JAB18617.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LHX5 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP
PSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGA
LHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW
Download sequence
Identical sequences A0A096N1Z4 A0A0D9S494 A0A2K5BWP6 A0A2K5MAM7 A0A2K5PPP9 A0A2K5W2A3 A0A2K6B8G3 F7I4X9 H2NIS2
ENSCJAP00000017993 ENSCJAP00000017993 9544.ENSMMUP00000002106 9600.ENSPPYP00000005694 ENSPPYP00000005694 ENSPPYP00000005694 ENSMMUP00000002106 ENSMMUP00000002106 ENSPANP00000006335 XP_001111705.1.72884 XP_002753087.1.60252 XP_002823842.1.23681 XP_005572389.1.63531 XP_008003022.1.81039 XP_011759244.1.29376 XP_011930421.1.92194 XP_012324438.1.9421 XP_017398875.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]