SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I6I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I6I5
Domain Number 1 Region: 38-98
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000707
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7I6I5
Sequence length 134
Comment (tr|F7I6I5|F7I6I5_CALJA) Inhibitor of DNA binding 2 {ECO:0000313|Ensembl:ENSCJAP00000011113} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ID2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MKAFSPVRSVRKSSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQSQTSRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
Download sequence
Identical sequences F7I6I5
ENSCJAP00000011113 ENSCJAP00000011113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]