SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I7H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I7H6
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.28e-33
Family Frizzled cysteine-rich domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7I7H6
Sequence length 674
Comment (tr|F7I7H6|F7I7H6_CALJA) Frizzled class receptor 6 {ECO:0000313|Ensembl:ENSCJAP00000029741} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=FZD6 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEMAYNMTFFPNLLGHYDQSIAAVEMKHFLPLAKLKCSPNVETFLCKAFVPTCTEQIHVV
PPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQ
VQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSNELEFAKSFIGIVSIFCLCA
TLFTFLTFLIDVKRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDT
VVLGSQNKACTILFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAW
GTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIIS
LNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVALLGCYIYEQVNRITWEITWVSD
HCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRK
RDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSA
VAITSHDYLGQETLTEIQTSPETSVREMRGDGASTPRLREQDCGEPASPAASSSRLSGEQ
VERKGQAGSVSEGARSEGRISPKSDITDTDRAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
GVRREQGGGCHSDT
Download sequence
Identical sequences F7I7H6
ENSCJAP00000029741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]