SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I955 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I955
Domain Number 1 Region: 88-214
Classification Level Classification E-value
Superfamily Lysozyme-like 1.3e-47
Family C-type lysozyme 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7I955
Sequence length 215
Comment (tr|F7I955|F7I955_CALJA) Sperm acrosome associated 3 {ECO:0000313|Ensembl:ENSCJAP00000026803} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LYZC OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVSALWGAPWIRVCSSPVSSPSASGPLRLVSRLSSQSSALSQSGGGATSFASTEARSRAL
RWRWCPAGTMLLALVSLLSCLFPSSDAKVYGRCELARVLQDFGLDGYRGYSLADWVCLAY
FASGFNTAAVDHEADGSTNNGIFQISSRRWCRNLTPHVPNMCQMYCSDLLNPNLKDTVIC
AMKITQEPQGLGYWEAWRHHCQGKDLTDWVDGCDF
Download sequence
Identical sequences F7I955
XP_002748420.1.60252 ENSCJAP00000051631 ENSCJAP00000026803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]