SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IA30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IA30
Domain Number 1 Region: 1537-1708
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-72
Family Endostatin 0.0000000462
Further Details:      
 
Domain Number 2 Region: 318-430
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.05e-23
Family Frizzled cysteine-rich domain 0.00043
Further Details:      
 
Domain Number 3 Region: 440-592
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-20
Family Trypanosoma sialidase, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IA30
Sequence length 1713
Comment (tr|F7IA30|F7IA30_CALJA) Collagen type XVIII alpha 1 chain {ECO:0000313|Ensembl:ENSCJAP00000043640} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=COL18A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAPDPSGRCVLLLLFCCLVAAQADLLDLSWLWPSKDTSHTAATVPKPTAGPTMLVAPQNG
STELETAPGNPKPPSELLEGGQDTPTSAESLDAPEKNIAGVGAEILNVKGIRSFVQLWND
TTPTESETLALKTPVGPLVLPVPSDAPWENGTVLWPGHRAPSSPGPHTTEAGILPAPTLS
PPSLGRPPAPLTGPPGPLPSSGRASLSSLLGRAPPWGSVSDLEGQGRPPGASAPGTQVRR
PNVCPHTPLLHPLVMGFLGHMAPFAFSSGLPGALSQVAVTTLIWDSGAWVSHAATSVGPG
LTNHSALLGVDPEAPSGHCLPLPPSLTVCGRLGFSRSWLPNHLHHESGEQVRAAARAWGG
LLRTHCHPFLAWFFCLLLAPCGRVPLPAPPPCRQFCEALQDVCWSRLAGGRLPVACTSLP
TQEDGYCVFTGPAAESIGEEVGLLQLLGDPLPQQVTQTEDPDVGLAYVFGPDANSGQVAR
YHFPSLFFHDFSLLFHIRPATEGPGVLFAITSIWAQAVVLLGVKLSGVQAEPGASQTHTA
ASFRLPFVGQWTQLALSVAGGSVTLYVDCEEFQRMPLARSSRGVVLSPGLGVLKADPAPL
AGTFNPDCSGAARSLTPNFSIEVLGKETFKLCDSQGLAEGSTELWVREETELPPGMPRPC
PAPRPPRMHPSSGCPGRPEEVAEATTGSCADTQTLPGSDSVSTWDGSVRTPGGRMKEGGL
KGQKGEPGVPGLPGRAGPPGSPCIPGPPGPPCPVSPQGPAGPALQPVPGPQGPPGLPGKD
GSPGRDGKPGDRGVIYRSGDTGPQGFPGTPGDMGPKGDKGDPGVGVRGPPGPQGPPGPPG
PSFRHDKLTFIDMEGSGFGGDLEALRGPRGFPGPPGPPGVPGLPGEPGRFGMNSSDVPGP
AGLPGVPGREGPPGIPGLPGPPGPPGREGPPGRTGQKGSLGEAGAPGLKGSKGDPGPAGA
RGESGLTGAPGPAGPPGPPGPPGPPGPGLPAGFDDMEGSGGPFWLTARGADGLQGPPGLP
GLKGDPGMPGPPGAKGEVGADGAPGFPGLPGREGTAGPQGPKGDRGSRGEKGDPGKDGVG
QPGLPGPPGPPGPVVYVSEQDGAVRSVPGSEGRPGFAGFPGPAGPKGDLGSKGERGSPGP
KGEKGEPGSIFSPDGSALGPAQKGAKGEPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNG
LKGEKGEPGDASLGIGMRGMPGPPGPPGPPGPPGTPLYDSNAFVELNRPGRPGLPGNRGP
AGPKGAKGEVGPPGPPGQFPFDFLQLEAEMKGEKGDRGDVGQKGERGELGGSGPPGPPGP
PGYPGIPGPKGESIRGQPGPPGPQGPPGIGYEGLQGPPGPPGPPGPPGAPSFPGPHRQTI
SIPGPPGPPGPPGPPGTMGASSGVRLWATRQAMLGQVHEVPEGWLIFVAEEEELFVRVRN
GFRKVQLEAQTLLTRGLDNEVAALQPPVVQLHDSNPHPWRGHPRPTARPWRADDILASPP
RLPEPQPYPGAPHHGSYVHLRPARPTSPPAHTHLNFQPVLHLVALNSPLTGSMRGIRGAD
FQCFQQARAVGLVGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDEVLFPSWEALFSGS
EGLLKTGARIFSFDGKDVLRHPTWPQKSVWHGSDPSGRRLTESYCETWRTDAPSVTGQAS
SLLGGSLLGQNAASCHHAYIVLCIENSFMTASK
Download sequence
Identical sequences F7IA30
ENSCJAP00000043640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]