SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IAX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IAX6
Domain Number 1 Region: 64-287
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.8e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000247
Further Details:      
 
Domain Number 2 Region: 355-468
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.06e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000597
Further Details:      
 
Domain Number 3 Region: 295-341
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000388
Family N-terminal domain of adrenodoxin reductase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IAX6
Sequence length 469
Comment (tr|F7IAX6|F7IAX6_CALJA) Glutathione reductase, mitochondrial {ECO:0000313|Ensembl:ENSCJAP00000046500} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GSR OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MALLPRALSSGGRPSWRRAARASRGFPLPPPFPAAATHALSRVMACRQEPQPQGPPPSAG
AVVSYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFLHDHGDYGFSSCEGKFNWRVIKEKRDTYVSRLNTIYQNNLTKAHIEIIHGHAVFTSDT
KPTIEVSGRKYTAPHILIATGGMPSSPHESQIPGASLGITSDGFFELEELPSRSVIVGAG
YIAVEIAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQGIKTDD
KGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFENKEDSKLDYNNIPT
VVFSHPPIGTVGLTEDEAIHKYGKENVKIYSTSFTPMYHAVTKRKTKCVMKMVCAYEEEK
VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences F7IAX6
ENSCJAP00000046500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]