SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IB12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IB12
Domain Number 1 Region: 128-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IB12
Sequence length 298
Comment (tr|F7IB12|F7IB12_CALJA) MLX, MAX dimerization protein {ECO:0000313|Ensembl:ENSCJAP00000009223} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MLX OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MTESGASPEDPWVKASPVGAHAGEGRVGRACARGGAGRRGASLLSPKSPMLSLPRGCREV
NSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVTSFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences F7IB12
ENSCJAP00000009201 XP_008994892.1.60252 ENSCJAP00000009223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]