SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ICD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ICD6
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.56e-123
Family Transglutaminase core 0.00000000957
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily E set domains 2.69e-45
Family Transglutaminase N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 610-707
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-24
Family Transglutaminase, two C-terminal domains 0.00076
Further Details:      
 
Domain Number 4 Region: 487-607
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.59e-22
Family Transglutaminase, two C-terminal domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7ICD6
Sequence length 712
Comment (tr|F7ICD6|F7ICD6_CALJA) Transglutaminase 7 {ECO:0000313|Ensembl:ENSCJAP00000005381} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TGM7 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
SPLVATLQLESVDLQISRNNKEHHTQEMGINRLTVRRGQPFHLRLSFSRPFQSKTNHITF
VAETGPKPSELLGTRATFFLTRVRPGNVWSASDFTTDSNSLQVSLFTPANAVIGHYTLKI
EISQGQDHSVTYLLGTFILLFNPWSAEDDVYLPSEILLQEYVMRDYGFVYKGHERFITSW
PWNYGQFEEDVIDICFEILNKSLYYLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWGEDYSKGVSPLEWNGSVAILRQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDRNLTIDTYYDRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAH
NTSSIGKEISTKMVGSDQRQSITSSYKYPEGSSEERAVFMKASRKMLGPQRASSPFLDLL
ESRDLRNQPVQLQLHLARMPEWGQDLQLLLRIWRVPDSTHPWGPIRLVVHFCAQALLHGG
GTQKPLWRHMVRLNLDFGKGLETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVEETGRSML
VLKDVSLEPPHLSIEVSERAEVGKALRVHITLTNNLMVALSSCMMVLEGSGLVNGQIAKD
LGTLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKEIKGYKNIFVTAAGAP
Download sequence
Identical sequences F7ICD6
ENSCJAP00000005381 ENSCJAP00000005381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]