SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ICZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ICZ5
Domain Number 1 Region: 199-276
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000134
Family Gar1-like SnoRNP 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7ICZ5
Sequence length 494
Comment (tr|F7ICZ5|F7ICZ5_CALJA) Nuclear assembly factor 1 ribonucleoprotein {ECO:0000313|Ensembl:ENSCJAP00000022748} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NAF1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEVVEAAAAQLETLKFNGTGFGVGEGPAAASPGSATAPGTQPSLQSHEGSPDTGQTVEVK
PAGEQPLQPFLNAIPAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDHLETSESDSDS
DSETDSDSSSSSSSSSSSSSSSSSSSCVSLPPVLSDGDDDLQVEKENKNFPLKTKDELLL
NELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGK
IFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDA
SWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFAEVHQNWNAHS
SASEHSKGYRNREFTRGFSRSRYPRFCHGRPLPQQFYNSEQMVSQETSGFPSQRQDNPIM
PQYPFPPPMFDMHNFSLCPPPPPPPPVNMRWATPNMAAHPLLNLPYSLPPPPPPPPLPPP
PSSGDSNSHFGPYY
Download sequence
Identical sequences F7ICZ5
ENSCJAP00000022748 XP_002745321.1.60252 ENSCJAP00000022743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]