SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ID05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ID05
Domain Number 1 Region: 185-262
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000012
Family Gar1-like SnoRNP 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ID05
Sequence length 463
Comment (tr|F7ID05|F7ID05_CALJA) Nuclear assembly factor 1 ribonucleoprotein {ECO:0000313|Ensembl:ENSCJAP00000022743} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NAF1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEVVEAAAAQLETLKFNGTGFGVGEGPAAASPGSATAPGTQPSLQSHEGSPDTGQTVEVK
PAGEQPLQPFLNAIPAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDHLETSESDSDS
DSETDSDSSSSSCVSLPPVLSDGDDDLQVEKENKNFPLKTKDELLLNELPSVEELTIILP
EDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYV
LRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALD
FSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFAEVHQNWNAHSSASEHSKGYRNREF
TRGFSRSRYPRFCHGRPLPQQFYNSEQMVSQETSGFPSQRQDNPIMPQYPFPPPMFDMHN
FSLCPPPPPPPPVNMRWATPNMAAHPLLNLPYGDSNSHFGPYY
Download sequence
Identical sequences F7ID05
ENSCJAP00000022743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]