SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ID41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ID41
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 81-124
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000248
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ID41
Sequence length 241
Comment (tr|F7ID41|F7ID41_CALJA) Helt bHLH transcription factor {ECO:0000313|Ensembl:ENSCJAP00000010753} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HELT OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQ
YLRALHSADFPRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAF
LQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGPGPFPWPPG
AARSPGLPYLPSAAVPLSSPAPQHSPFLTPVQCLDRHYLNRIGHAHPNALNLHTPQHPPV
L
Download sequence
Identical sequences F7ID41
ENSCJAP00000010753 XP_008990635.1.60252 ENSCJAP00000010753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]