SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IDU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IDU5
Domain Number 1 Region: 8-76
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000288
Family GAF domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IDU5
Sequence length 98
Comment (tr|F7IDU5|F7IDU5_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000026786} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PDE11A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
VMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTL
LKCERCSVLLLEDIESPLSGFVKPFGFQGEICWVDKQH
Download sequence
Identical sequences F7IDU5
ENSCJAP00000026786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]