SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IDZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IDZ7
Domain Number 1 Region: 54-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000105
Family HLH, helix-loop-helix DNA-binding domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IDZ7
Sequence length 209
Comment (tr|F7IDZ7|F7IDZ7_CALJA) MAX dimerization protein 4 {ECO:0000313|Ensembl:ENSCJAP00000026544} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MXD4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MELNSLLILLEAAEYLERRERGSGGAPLCARGDGRAEPRPPPGACSRGPDSPSSHNELEK
HRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKEGIERAGHRCCGDRHRIGLG
VPEETCCKQGCPGEGASQSVRVQRDWTGRVGGRGRADHEVDIEGMEFGPGELDSVGSSDA
DDHYSLQSGSSSDSGFGPHCRRLGRPALL
Download sequence
Identical sequences F7IDZ7
ENSCJAP00000026544 ENSCJAP00000026536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]