SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IFD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IFD5
Domain Number 1 Region: 56-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000118
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IFD5
Sequence length 333
Comment (tr|F7IFD5|F7IFD5_CALJA) Stimulated by retinoic acid 8 {ECO:0000313|Ensembl:ENSCJAP00000022923} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=STRA8 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
QNPLEADKIVFLLSRVKRNITLQLIMATPEESSNPHESMTPQLPAQPQDLDSRVARRRLS
QARHRATLAALFDNLRKTVYSQSDLTASKWQVLNKAKSYIPELEQTLDNLLKLKVSLNLE
DGHASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIVSLQEGALPIV
SAAISHLWQNLSEERKASLRQAWAQKHRDPASLAGACREAACAEGSMKDSGVDSQGASCS
LVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASSNPENPEEKFQLYMQIINFFKGL
GCANTRVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences F7IFD5
ENSCJAP00000022923 ENSCJAP00000051264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]