SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IGC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IGC8
Domain Number 1 Region: 53-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IGC8
Sequence length 207
Comment (tr|F7IGC8|F7IGC8_CALJA) MAX dimerization protein 4 {ECO:0000313|Ensembl:ENSCJAP00000026538} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MXD4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MELNSLLILLEAAEYLERRERGSGGAPFPHCSGPFWDQKASCSCLCLSVSLNRSSHNELE
KHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKVGGEPSGRCVGPGGFHQDC
ALCGSAPLPRASVSRKERDGPAPSTWPDPIPALFSSEVDIEGMEFGPGELDSVGSSDADD
HYSLQSGSSSDSGFGPHCRRLGRPALL
Download sequence
Identical sequences F7IGC8
ENSCJAP00000026538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]