SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IGF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IGF8
Domain Number 1 Region: 220-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-21
Family SPRY domain 0.00072
Further Details:      
 
Domain Number 2 Region: 79-149
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000139
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IGF8
Sequence length 353
Comment (tr|F7IGF8|F7IGF8_CALJA) Ring finger protein 39 {ECO:0000313|Ensembl:ENSCJAP00000038502} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RNF39 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MWWRDWPRLRLLKREAIPGEGQKAAKVNAGVGEKGIYTASSRGGPPSARSKAVAVVAERA
ASRSRLSMDAPELGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARRWGTPPA
TGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELRQKLAEPGALAGRRRGGRIPTM
GSLDPHGEDMRKTWRRFEVPAPKSPNPEADLPEDYPVVKNMLHRLTADLTLDPGTAHHRL
LISADRRSVQLAPPGTPSPPDAPTRFDQLPAVLGAQGFGAGRHCWEVETGDAASCRDSSG
EDEDDGESHYAVGAAGESVQRKGRAPGPLGERIFPLFCTRDPRAPLRIVPAES
Download sequence
Identical sequences F7IGF8
ENSCJAP00000038502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]