SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IH82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IH82
Domain Number 1 Region: 18-349
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.28e-79
Family Pancreatic carboxypeptidases 0.000001
Further Details:      
 
Domain Number 2 Region: 349-411
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.28e-16
Family Carboxypeptidase regulatory domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IH82
Sequence length 411
Comment (tr|F7IH82|F7IH82_CALJA) Carboxypeptidase N subunit 1 {ECO:0000313|Ensembl:ENSCJAP00000031622} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CPN1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSDLLSVFLHLLLLFKLVAPVTFSHHRYDDLVRTLYKVQNECPSITRVYSIGRSVEGRHL
YVLEFSDHPGIHEPLEPEVKYVANMHGNEALGRELMLQLSEFLCEEFRNRNQRIVRLIQD
TRIHILPSMNPDGYEVAAAQGPNKLGYLVGRNNANGVDLNRNFPDLNTYIYYNEKSGGPN
HHLPLPDNWKIMVPVHTELFVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDRSFEH
PVRGVRRPANTPTPDDKLFRKLAKIYSYAHGWMYQGWNCGDYFPDGIINGASWYSLSKGM
QDFNYLHTNCFDITLELSCNKFPPQEELQREWLGNREALIQFLEEVHQGIKGMVLDENYN
NLANAVISVSGINHDVTSGDHGDYFRLLLPGTYTVTAKAPGFDSQTETVTV
Download sequence
Identical sequences F7IH82
ENSCJAP00000031622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]