SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7II89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7II89
Domain Number 1 Region: 45-146
Classification Level Classification E-value
Superfamily POZ domain 3.73e-31
Family Tetramerization domain of potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7II89
Sequence length 232
Comment (tr|F7II89|F7II89_CALJA) Potassium channel tetramerization domain containing 17 {ECO:0000313|Ensembl:ENSCJAP00000023287} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCTD17 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
SPARRTDLLGRAKQGGVGSGSSAGAGPSPRPTLSQGARTTGGWGKWVRLNVGGTVFLTTR
QTLCREQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEE
GVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQELPVFRVLSPPPLKLVTLGQVHGPSLGPR
WLVNIGSSYSYGSEDQAEFLCVVSKELHSSPNGLSSESGRKTKVSPPASARV
Download sequence
Identical sequences F7II89
ENSCJAP00000023287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]