SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IID5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IID5
Domain Number 1 Region: 570-757
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 300-475,505-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IID5
Sequence length 1094
Comment (tr|F7IID5|F7IID5_CALJA) Potassium voltage-gated channel subfamily H member 7 {ECO:0000313|Ensembl:ENSCJAP00000011055} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCNH7 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
GSTFICNTHIIPVKNQEGVAMMFIINFEYVTDDENATSPQRVNPILPVKTVNRKFFGFKF
PALRVLTYRKQSLPQEDPDVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQP
SKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGF
SVHPKNIFRDRHASEDNGRNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDV
KTEKKNSSPPSSDKTIIAPKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILH
YSPFKAVWDWLILLLVIYTAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMF
IIDILINFRTTYVNQNEEVVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTL
IGLLKTARLLRLVRVARKLDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLT
DKIGWLDSLGQQIGKRYNDSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKI
FSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEE
YFQHAWTYTNGIDMNMVLKGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFK
TTHAPPGDTLVHCGDVLTALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSN
ADVRALTYCDLHKIQREDLLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMND
SEGDNCKLRRRKLSSESEGGRENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSID
DEQKPLFSGIVDSSPGIGKASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHP
QPEDSSSSAQQRAAWGISETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQK
QTTVVPPAYSMVTAGAEYQRPIIRLMRTSQPLASIKTDRSFSPSSQCPEFLDLEKSKLKS
KESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYLHPIRHPSLPESSLSTVGIL
GLHRHVSDPGLPGK
Download sequence
Identical sequences F7IID5
ENSCJAP00000011055 ENSCJAP00000011055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]