SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IIZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IIZ7
Domain Number 1 Region: 10-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-21
Family Ubiquitin-related 0.0000307
Further Details:      
 
Domain Number 2 Region: 652-662
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IIZ7
Sequence length 1046
Comment (tr|F7IIZ7|F7IIZ7_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000002140} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=BAG6 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGSQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGGPPPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGSQPQHSQPPPQPPTVTPEPVALSSQTSEPAESEAPPREPMEAEEVEEHTPAQ
NPELTPSGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAA
TTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYT
TPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSTE
GAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGSLGPPGHG
QTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLV
GQLLMQPVLVAQGTSGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTQPSTADLQ
FSQLLGNLLGPAGPGAGGPGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPP
PPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARAGSSESI
AAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLR
SFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQF
NSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGV
NPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPE
PQRENASPAPGTTAEEVMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDI
QSQRKVKPQPPLSDAYLSGMPAKRRK
Download sequence
Identical sequences F7IIZ7
ENSCJAP00000002140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]