SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IJH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7IJH1
Domain Number - Region: 67-142
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IJH1
Sequence length 159
Comment (tr|F7IJH1|F7IJH1_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000005545} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SCOC OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRRRIFSSQDWRVRGRDEAGLFFRRTFCGRSGRSCRCQLVQVSPPEVSAASFSLPAPPAE
DHSARIFYRRPKSLLPKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDA
VKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
Download sequence
Identical sequences F7IJH1
ENSCJAP00000005548 ENSCJAP00000005545 XP_002745383.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]