SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IK66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IK66
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.98e-35
Family SCAN domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 672-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-27
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 728-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 589-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 326-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 10 Region: 865-924
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 11 Region: 909-961
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 12 Region: 784-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000206
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 13 Region: 953-1009
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000764
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 635-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000109
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 15 Region: 220-276
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000445
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Weak hits

Sequence:  F7IK66
Domain Number - Region: 834-861
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00259
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IK66
Sequence length 1009
Comment (tr|F7IK66|F7IK66_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000034693} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LOC100400493 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPPGQELFRLRFRQLCYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGE
EVVTLLEDLERQIDILGRPFLFDKDENGFSTVWVSARVRGHRVLWEEVVHSESAPEPPST
QLQSEASQHKSPVSQESQSPTSSQKGSSGNQEMTATLLTAGFQTLEKIEDMAVSLIREEW
LLDPSQKDLSRDNRPENVRNMFSLGGETRSENRELASKQVISTGIQQHGETAAKCNGDVI
GGLEHGEARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNV
CGKAFSYRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKA
FSQSAGLILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRS
SHLIGHQRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLI
QHLRIHTGEKPYQCNECGKAFIQRSSLIRHQRIHSEERRYKCSECGKKFAQSSGLVRHQR
IHTGEKPYECDHCGKAFSVRSTLTVHERIHTGEKPYSCNECKKAFSVRAHLIIHQRIHNG
EKPYECNECGKAFSVSSDLIKHQRIHTGEKPYECDECGKAFSVSSALIKHQRIHTGEKPY
ECKECGKAFYVNSALINHQRIHSGEKPYECGECGKAFSQISTLIHHQRIHTGEKPYECEE
CGKAFRGSSNLTKHQRIHAKEKPHQCSKRGRCFSQRSVLRKHQSLHTGKKPLKCGKAFCH
SSHVIQSQQFHSKEKPCECNECGKAFRQHSHLTEHQRIHSEEKPYECKVYGKAFTNQSSE
LIIRHRIIHSGGKPYECAECGKAFSVSSTLIIRQRSYTGEKPYKCDECGDTMSQSSGLNK
HKHSSDYEVKPCECQVCSKAFSQKTGLRHHVRIHTGEKPFECSERERAF
Download sequence
Identical sequences F7IK66
ENSCJAP00000034693 ENSCJAP00000034693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]