SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IKS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7IKS4
Domain Number - Region: 284-327
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0249
Family Frizzled cysteine-rich domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IKS4
Sequence length 397
Comment (tr|F7IKS4|F7IKS4_CALJA) Family with sequence similarity 155 member B {ECO:0000313|Ensembl:ENSCJAP00000023001} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=FAM155B OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MFRGAWMWPGKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADH
LWLCAGARPRAKELSSAMRPPWGAGRERQRVPPRAMLPLPPPPPGEPSAPPGACGPRYSN
LTKAAPAAGSRPVCGGVPEPKGLDAACTKLQSLQRLFEPTTPAPPLRPPDSPSRAPAEFP
SAKKNLLKGHFRNFTLSFCDTYTVWDLLLGMDRPESLDCSLDTLLGDLLAVVASPGSGTW
EACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFS
VTQQECQRWVPCKQYCLEVQTRCPFLLPDNEEMVYGGLPGFICTGLLDTSPKRPETKCCD
VQWVSCEAKKKKIKESEAPKTHHQQFHHSYFPHYHQQ
Download sequence
Identical sequences F7IKS4
ENSCJAP00000023001 ENSCJAP00000023001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]