SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ILB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ILB4
Domain Number 1 Region: 98-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ILB4
Sequence length 362
Comment (tr|F7ILB4|F7ILB4_CALJA) Neurogenic differentiation factor {ECO:0000256|PIRNR:PIRNR015618} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NEUROD2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKSDAPPPPPPAPGAPGPARAAKPVSLRG
DEVPEATLAEEGLDEAEGERPKKRGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPT
TNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGG
AAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHE
KSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFF
HN
Download sequence
Identical sequences F7ILB4
ENSCJAP00000052394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]