SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ILM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ILM9
Domain Number 1 Region: 44-368
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.48e-77
Family Pancreatic carboxypeptidases 0.00000175
Further Details:      
 
Domain Number 2 Region: 368-447
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.94e-18
Family Carboxypeptidase regulatory domain 0.00088
Further Details:      
 
Weak hits

Sequence:  F7ILM9
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0419
Family Frizzled cysteine-rich domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ILM9
Sequence length 517
Comment (tr|F7ILM9|F7ILM9_CALJA) Carboxypeptidase Z {ECO:0000313|Ensembl:ENSCJAP00000040021} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CPZ OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAWPYFLDCHRYFKREDEGCYDPLEKLRGGLEADEVLPSGLPPTFIRFSHHSYAQMARVL
RRTAARCAHVARTYSIGRSFDGRDLLVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREM
LIYLTQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQ
NLDLNRNFPDLTSEYYRLAGTRSVRSDHIPIPEHYWWGKVAPETKAIMKWMQTIPFVLSA
SLHGGDLVVSYPFDFSKQPQEEKMFSPTPDEKTFKLLSRAYAEVHPMMMDRSENRCGGNF
LKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYTIWQHNKESLLN
FVETVHRGIKGVVMDKYGKPVKNARILVKGIRHDITTAPDGDYWRLLPPGTHIVIAQAPG
YARLIKKVIIPARMKRAGRVDFILQPLGVGPKNFLPGLRRTGPHDPLGGASPLGEGTEPN
PDPLRARRQPSAGGSKPWWWSYFTSLSAHRPRWLLKY
Download sequence
Identical sequences F7ILM9
ENSCJAP00000040021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]