SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IMG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7IMG9
Domain Number - Region: 177-223
Classification Level Classification E-value
Superfamily DNA primase core 0.0968
Family DNA primase DnaG catalytic core 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IMG9
Sequence length 694
Comment (tr|F7IMG9|F7IMG9_CALJA) Chromosome 14 open reading frame 37 {ECO:0000313|Ensembl:ENSCJAP00000034685} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=C14orf37 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSGPIVLHICLAFCSLLLFNIATQCLAFPKIERREITHVHAEKGQSDKMNTDDLENSSVT
SKQTPQLEVSEDPMMVSAGPSATSLSKAFSLNKETQPGRAALMQTDRPGVSTATESAVPA
GEEVFGSSQPEGISPESGLSKSMLTIAITASASLTIGKKQELLTSTNFQPIVEETTEAPK
GFLKYMDNQSFTTESQEGFGLGHSPSSYGNTKEMVTTNPRTEKFEADTDHRTTSFPDAES
TAGTEPGNLPPDKEKPLQMTGDNTQAAASRQLLTTSEYTLSVQPETDSLLGASEVTVSAS
TAVPATSALSGEWDDTKLESVSQTGTPKLRDNAETQVRMETQTAQVSHEGVEGGQSWTEA
LEVVLGLPEGETHTGTALLILHGNERSPAFTDQSSFTPTSVMEDTKVSVVNLLQSTGDFT
ESTKENDTLFFSETTVSVSEYELEADQLLGNTMKDIITQEMTTAVQEPDATLSVVTQEEV
APLELIRDSGKTEEEKEDLSPGSDVSGVTQLSRRWQPLATTISTTVVPWFFEVTPTVEEQ
VDTVTGTNEEFTPVLGSPVTPPGIMVGEPSIFPALPASETSSEGRTVVPSITRVNTAASY
GLDQLESEAGKGDCPVKKIQKEGEKETLESSLEQDKDADSLDEGLDGDTELPGFTLPAVT
SQEPGLEQGNMDLLEGATYQVPDAIEWEQQNQGL
Download sequence
Identical sequences F7IMG9
ENSCJAP00000034685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]