SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IPG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IPG9
Domain Number 1 Region: 50-375
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.97e-72
Family Pancreatic carboxypeptidases 0.00000124
Further Details:      
 
Domain Number 2 Region: 375-471
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.47e-22
Family Carboxypeptidase regulatory domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IPG9
Sequence length 476
Comment (tr|F7IPG9|F7IPG9_CALJA) Carboxypeptidase E {ECO:0000313|Ensembl:ENSCJAP00000017093} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CPE OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAGRGGRALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELR
EALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVE
RELLFFLAQYLCNEYQKGNETIVNLIHNTRIHIMPSLNPDGFEKAASQPGELKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPC
RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWED
NKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK
LTASAPGYLAITKKVAVPYSPAVGVDFELESFSERKEEEKEELMEWWKMMSETLNF
Download sequence
Identical sequences F7IPG9
ENSCJAP00000017093 ENSCJAP00000017093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]