SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IR04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IR04
Domain Number 1 Region: 95-163
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 329-375
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000429
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IR04
Sequence length 381
Comment (tr|F7IR04|F7IR04_CALJA) Mex-3 RNA binding family member A {ECO:0000313|Ensembl:ENSCJAP00000014282} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MEX3A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
KGSSNTTECVPVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDV
ATARREIISAAEHFSMIRASRNKSGAAFGVAPALPGQVTIRVRVPYRVVGLVVGPKGATI
KRIQQQTNTYIITPSRDRDPVFEITGAPGNVERAREEIETHIAVRTGKILEYNNENDFLA
GSPDAALDSRYSDAWRVHPPGCKPLSTFRQNSLGCIGECGVDSGFEAPRLGEQGGDFGYG
GYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVQARAGPPGAHRSPATSAGPELAG
LPRRPPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAALVPCGHNLFCMECAVRICE
RTDPECPVCHITATQAIRIFS
Download sequence
Identical sequences F7IR04
ENSCJAP00000014282 ENSCJAP00000014282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]