SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IRD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IRD7
Domain Number 1 Region: 399-681
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.42e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000932
Further Details:      
 
Domain Number 2 Region: 268-398
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.75e-37
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00094
Further Details:      
 
Domain Number 3 Region: 683-790
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.17e-26
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Weak hits

Sequence:  F7IRD7
Domain Number - Region: 221-266
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0823
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IRD7
Sequence length 800
Comment (tr|F7IRD7|F7IRD7_CALJA) Threonyl-tRNA synthetase like 2 {ECO:0000313|Ensembl:ENSCJAP00000031982} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TARSL2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAAEALAAEAVASRLERQEEDIRWLWAEVQRLRDEQLSAPDRGQAEGPCVTREVAQLRAE
NRDLRHRLCRLRLCLAEELSRQATLGRAAREAGRTGAGAQPPSSQSREKDMKKKKMKESE
PDHEVKQQPSFIKERLNLFEILKKDHQLLLAIYGKKGDRSNVITVRVADGQTVEGEVWKT
TPYQVAAEISILEPGENVFLGTANISLRKLTVMAEGEASLSFFTWQQQGEVQSKYSHFYT
DFIHQSNHFHEGNASCPEGRCGFCALPFRAVSSTELSALENICKVIIKEKQPFERLEVSK
EILLEMFKYNKFKCRILNEKVSTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSST
YWEGNPEMETLQRIYGISFPDNKMMRNWEKFQEEAKNRDHRKIGKEQELFFFHDLSPGSC
FFLPRGAFIYNTLVDFIREEYHKRDFTEVLSPNMFNSKLWEASGHWQHYSENMFTFEIEK
DTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDA
HIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQNSL
MEFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDGDDK
KRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEFFE
EGFMADIDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNRIHGEILVTS
AIDKLKNLKKSRALSAEEDF
Download sequence
Identical sequences F7IRD7
ENSCJAP00000031982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]