SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IRL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IRL1
Domain Number 1 Region: 132-366
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.8e-54
Family Regulator of chromosome condensation RCC1 0.0062
Further Details:      
 
Domain Number 2 Region: 765-870
Classification Level Classification E-value
Superfamily POZ domain 1.04e-20
Family BTB/POZ domain 0.0087
Further Details:      
 
Domain Number 3 Region: 32-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-18
Family Ankyrin repeat 0.00094
Further Details:      
 
Domain Number 4 Region: 541-642
Classification Level Classification E-value
Superfamily POZ domain 7.46e-16
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IRL1
Sequence length 1350
Comment (tr|F7IRL1|F7IRL1_CALJA) Inhibitor of Bruton tyrosine kinase {ECO:0000313|Ensembl:ENSCJAP00000017485} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=IBTK OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MNSPMPDCTSKCRSLKHALDILSVVTKGSENQIKAFLSSHCCNAATIKDVFGRNALHLVS
SCGKKGVLDWLIQKGVDLLVKDKESGWTALHRSIFYGHIDCVWSLLKHGVSLYIQDKEGL
SALDLVMKDRPTHVVFKNTDPADVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGIYIK
QVVLCKFHSVFLSQKGQVYTCGHGPGGRLGHGDEQTCLVPRLVEGLSGHNCSQVAAAKDH
TVVLTEDGCVYTFGLNIFHQLGIIPPPSSCNVPRQIQAKYLKGRTIIGVAAGRFHTVLWT
REAVYTMGLNGGQLGYLLDPNGEKCVTAPRQVSALHHKDIAVSLVAASDGATVCVTTRGD
VYLLADYQCKKMASKQLNLKKILVSGGHMEYKVDPEHLKENGGQKICILAMDGAGRVFCW
RSVSSSLKQCRWAYPRQVFISDIALNRNEILFVTKDGEGFRGRWFEEKRKNSEKKEILSN
LHNSSSDVSCVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPA
VSSSSFFEEFGKLLRETDEMDNIHDVTFQVVNRIFPAHKYILAARSDFFQKLFLSDDTTL
ECTDVYRKDEDSAGCHLFVVEKVHPDMFEYLLQFIYTDTCDFLTHGFKPRIHLNKNAGEY
QGTVNSHLNKVNFHEDNNQKSAFEVYKSNQVQTISERQKSKPKSCKKGKNVGEDDPVRML
QTVAKKFGFSNLSSRLDGVRFENEKINVIAKKTGNKQKLSQKKCSFLCDVTMKSVDGKEF
PCHKCVLCARLEYFHSMLNSSWIEASSCAALEMPIHSDILKVILDYLYTDEAVVIKESQN
VDFICSVLVVADQLLITRLKEICEVALTEKLTLKNAAMLLEFAAMYNAKQLKLSCLQFIG
LNMAALLEARSFDVLSDGVLKDLSEFYRKMIPAMDRRIITPYEDGPDISYLEVEDGDIFL
KEDINMEQNYSETMFKKAKTKAKKKPRKRSDSSGGYNLSDIIQSPSSTGLLKAGKTNSME
SLPELLTSDSEGSYAGVGSPRDLQSPDFTTGFHSDKIEVKVKPYVNGTSSMYSREDLKPW
GKSPILKISSPQPIPSNRIDTTNSASWVAGSFSPVSPPVVDLRTIMETEESRQKCGATPK
SNLGKTVSHGVKLSQKQRKMIALTSKENNSGMNSMETVLTTPSKAPKPVNAWASPLHSVS
SKSFRDFLLEEKKSITSFSDHVKKVCFKGIEISASKFCRCSTHGTPGPEGNHISDLPLLD
SPNPWLSSSVTAPSVVAPVTFASIVEEELQQEAALIRSREKPLALIQIEEHAIQDLLVFY
EAFGNPEEFVIVERTPQGPLAVPMWNKHGC
Download sequence
Identical sequences F7IRL1
ENSCJAP00000017485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]