SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IS92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IS92
Domain Number 1 Region: 308-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-70
Family SPRY domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-20
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 92-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.44e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IS92
Sequence length 513
Comment (tr|F7IS92|F7IS92_CALJA) Zinc finger protein RFP {ECO:0000313|EMBL:JAB06702.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TRIM27 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MASASVAECLQQETTCPVCLQYFSEPMMLDCGHNICGACLARCWGAAETNVSCPQCRETF
PQRHLRPNRHLANVTQLVKQLRSERPVGPGGEMGACEKHREPLKLYCEQDQTPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSGLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTEGLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGVFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
Download sequence
Identical sequences F7IS92
ENSCJAP00000022668 ENSCJAP00000022668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]