SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7IT16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IT16
Domain Number 1 Region: 59-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IT16
Sequence length 146
Comment (tr|F7IT16|F7IT16_CALJA) Inhibitor of DNA binding 1, HLH protein {ECO:0000313|Ensembl:ENSCJAP00000038670} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ID1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MKVASGSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDM
NGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTAGGRGLPVRAPL
STLNGEISALTAEAACVPADDRILCR
Download sequence
Identical sequences F7IT16
ENSCJAP00000038670 ENSCJAP00000038670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]