SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7UUA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7UUA3
Domain Number 1 Region: 48-92,158-193
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000315
Family Di-heme elbow motif 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7UUA3
Sequence length 193
Comment (tr|F7UUA3|F7UUA3_EEGSY) Uncharacterized protein {ECO:0000313|EMBL:BAK44776.1} KW=Complete proteome; Reference proteome OX=502558 OS=Eggerthella sp. (strain YY7918). GN=EGYY_16360 OC=Eggerthellaceae; Eggerthella.
Sequence
MTLSAAGFTFCLFVALALVGCQSTPSDRALMPGIAAAEQISPQDWKWSPDQECAPCHSIE
AHTAAASACTDFSDASSSCLTCHNVEQELTVAHEDIRNVKPVSDLQQVTVEKEVCTRCHT
IASLAERTADSVALADNNGVTINPHALLKTKGHSEIDCTACHTMHESSDRLETSSKMCRE
CHHADSFECESCH
Download sequence
Identical sequences F7UUA3
gi|339445173|ref|YP_004711177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]