SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7W5E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7W5E4
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-33
Family spliceosomal protein U5-15Kd 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7W5E4
Sequence length 143
Comment (tr|F7W5E4|F7W5E4_SORMK) WGS project CABT00000000 data, contig 2.30 {ECO:0000313|EMBL:CCC12732.1} KW=Complete proteome; Reference proteome OX=771870 OS=K-hell). GN=SMAC_05691 OC=Sordaria.
Sequence
MGSIVLPHLETGWHVDQAILSEDERVVVIRFGRDHSPDCMRQDEVLYRIADKVKNFAVIY
LCDIDKVPDFNQMYELYDECTLMFFFRNKHMMIDLGTGDNNKIKWVLEDKQELIDIIETV
YRGAKKGRGLVVSPKDYSTRHRY
Download sequence
Identical sequences A0A0B0DG49 F7W5E4 F8MT92 G4UWJ4 V5IMB3
jgi|Neute1|82531|e_gw1.14.203.1 NCU08395T0 NCU08395T1 XP_003348596.1.50522 XP_009852718.1.73169 XP_011395277.1.24337 XP_011395278.1.24337 jgi|Neudi1|156808|estExt_fgenesh3_pm.C_80084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]