SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7YTY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7YTY3
Domain Number 1 Region: 43-139
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000115
Family FCH domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7YTY3
Sequence length 184
Comment (tr|F7YTY3|F7YTY3_9THEM) Uncharacterized protein {ECO:0000313|EMBL:AEH51565.1} KW=Complete proteome; Reference proteome OX=688269 OS=Pseudothermotoga thermarum DSM 5069. GN=Theth_1512 OC=Pseudothermotoga.
Sequence
MKKFLAILLVVILASTVVLAAPMMKVKSFGPGYGPVKPWFGWQAREELRFQEKEQLKERA
RETLKEMYKKAFETGKLTKEQAQQILNIINEAKEKLNALQKEFEELRQKASKMTLNEYRN
AVRELNQKRAEITKEAAQKIGDIVTVEQLELLRSQLRFTFKKCYVPTLNFFDEVILKALE
EYAK
Download sequence
Identical sequences F7YTY3
gi|338731269|ref|YP_004660661.1| WP_013932777.1.44118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]